Schistosoma mansoni: Smp_130230 Help Entry Smp_130230        CDS       T01095                                  Name (RefSeq) rac gtpase, putative   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism smm  Schistosoma mansoni Pathway smm04145   Phagosome smm04148   Efferocytosis smm04310   Wnt signaling pathway smm04620   Toll-like receptor signaling pathway smm05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:smm00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     Smp_130230  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     Smp_130230    04148 Efferocytosis     Smp_130230  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     Smp_130230  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     Smp_130230  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:smm04131]     Smp_130230   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:smm04147]     Smp_130230    04031 GTP-binding proteins [BR:smm04031]     Smp_130230 Membrane trafficking [BR:smm04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     Smp_130230  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     Smp_130230   Macropinocytosis    Ras GTPases     Smp_130230  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     Smp_130230 Exosome [BR:smm04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Smp_130230   Exosomal proteins of other body fluids (saliva and urine)    Smp_130230   Exosomal proteins of colorectal cancer cells    Smp_130230   Exosomal proteins of bladder cancer cells    Smp_130230 GTP-binding proteins [BR:smm04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     Smp_130230 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf Motif Other DBs NCBI-GeneID:  8347330 NCBI-ProteinID:  XP_018644134 LinkDB All DBs Position Unknown AA seq 168 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYVPTVFDNYSANVMVDRKPVNLGLWDTAG QEDYDRLRPLSYPQTDVFLVCFSLVSRTSFENVRSKWHPEISAYVPRAPIILVGTKRDLR DSPNGLKSTTFPVTYAEMKSLMYIRDRFSIHNETYIQFTECSPLKSIN NT seq 507 nt NT seq  +upstreamnt  +downstreamnt atgcaagccatcaaatgtgtggttgtcggtgatggcgctgtcggaaagacctgtttactc attagctacacgacgaatgcctttcctggtgagtacgtcccaaccgttttcgataactat tctgccaacgtaatggttgaccgaaaacctgtgaaccttggtttgtgggatacagctggt caggaggattatgacagactaagaccactctcatatccacaaactgatgtgtttttggtg tgcttctccttagtcagtcgcacatcgttcgagaatgttcgtagtaaatggcatccggag atatccgcatatgttccaagagctcctattattcttgtcggaactaaacgagaccttcgg gatagtcctaatggcctaaaatcaacaacgtttccagtcacgtatgcagagatgaaatca ttaatgtatattagagatagattttcaattcataatgaaacttacattcagtttacagaa tgcagtccactgaaatcaatcaactaa

DBGET integrated database retrieval system