Schistosoma mansoni: Smp_177140 Help Entry Smp_177140        CDS       T01095                                  Name (RefSeq) histone H3, putative   KO K11253   histone H3 Organism smm  Schistosoma mansoni Brite KEGG Orthology (KO) [BR:smm00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:smm03036]     Smp_177140   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:smm04147]     Smp_177140 Chromosome and associated proteins [BR:smm03036]  Eukaryotic type   Nucleosome assembly factors    Histones     Smp_177140 Exosome [BR:smm04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Smp_177140 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone Motif Other DBs NCBI-GeneID:  8351697 NCBI-ProteinID:  XP_018644435 LinkDB All DBs Position Unknown AA seq 93 aa AA seqDB search MARPKQTARKSTGGKAPPKQLATKAARKSAPATGGVKEPYRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDRSTIPELSRVCSSGS NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggcacgaccaaagcagacagctcgcaaatcaacgggaggtaaggcacctcctaagcaa ctggccaccaaggctgcgcgtaaaagtgcaccggctaccggtggcgtgaaggagccatac agataccgacccgggaccgttgcccttcgagagatccgtcgttaccagaagagcaccgaa ctcctgattcgtaaacttccattccagcgtttggtccgagagatcgctcaagaccgatct acgattccagagctcagccgtgtctgctcttcaggaagctag

DBGET integrated database retrieval system