Selaginella moellendorffii: SELMODRAFT_111873 Help Entry SELMODRAFT_111873 CDS       T01496                                  Name (RefSeq) hypothetical protein   KO K03014   DNA-directed RNA polymerases I, II, and III subunit RPABC2 Organism smo  Selaginella moellendorffii Pathway smo03020   RNA polymerase smo03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:smo00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     SELMODRAFT_111873   09124 Replication and repair    03420 Nucleotide excision repair     SELMODRAFT_111873  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:smo03021]     SELMODRAFT_111873    03400 DNA repair and recombination proteins [BR:smo03400]     SELMODRAFT_111873 Transcription machinery [BR:smo03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      SELMODRAFT_111873   RNA polymerase III system    RNA polymerase III      SELMODRAFT_111873   RNA polymerase I system    RNA polymerase I      SELMODRAFT_111873 DNA repair and recombination proteins [BR:smo03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       SELMODRAFT_111873 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_Rpb6 Motif Other DBs NCBI-GeneID:  9647354 NCBI-ProteinID:  XP_002980022 JGI:  111873 UniProt:  D8S9V8 LinkDB All DBs Position Unknown AA seq 96 aa AA seqDB search EAESEQVSDKPRKTTKYMTKYERARVLGTRALQISMNAPVMVELEGETDPLEIAMKELRE RKIPFTIRRYLPDGSYEDWGVDELIVEDSWKRQVGN NT seq 291 nt NT seq  +upstreamnt  +downstreamnt gaggcggagagcgaacaggtcagtgataagcccaggaagacaaccaagtatatgaccaag tatgagagagctcgcgttcttgggacacgggctttgcaaatcagtatgaacgctccagtg atggtggaactcgagggcgagacagatccactcgagattgctatgaaggagctgcgtgaa cggaagatcccttttacgattcggcggtacctccctgatggaagctacgaggattggggc gtagacgagctgattgtggaggattcttggaagagacaagttggaaactag

DBGET integrated database retrieval system