Selaginella moellendorffii: SELMODRAFT_150734 Help Entry SELMODRAFT_150734 CDS       T01496                                  Name (RefSeq) hypothetical protein   KO K03008   DNA-directed RNA polymerase II subunit RPB11 Organism smo  Selaginella moellendorffii Pathway smo03020   RNA polymerase smo03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:smo00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     SELMODRAFT_150734   09124 Replication and repair    03420 Nucleotide excision repair     SELMODRAFT_150734  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:smo03021]     SELMODRAFT_150734    03400 DNA repair and recombination proteins [BR:smo03400]     SELMODRAFT_150734 Transcription machinery [BR:smo03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Core subunits      SELMODRAFT_150734 DNA repair and recombination proteins [BR:smo03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       SELMODRAFT_150734 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_L_2 RNA_pol_L Motif Other DBs NCBI-GeneID:  9630425 NCBI-ProteinID:  XP_002975776 JGI:  150734 UniProt:  D8RRF0 LinkDB All DBs Position Unknown AA seq 117 aa AA seqDB search MNAPDRYERFVVPEGTKKVAYERDMKVMNAGAFTIQREDHTVGNVVRMQLHRDPNVLFAG YKLPHPLQYKIIVKVQTTSQSSPIQAYNLALSDLDKELEHLKRAFESEVAQRQTDYY NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgaacgcgccggatcgctatgagcgcttcgtcgttcccgagggcaccaagaaggttgcg tatgagagggatatgaaggtaatgaatgccggcgctttcaccattcagcgagaagatcac actgttggaaacgttgtccgcatgcagctacaccgcgatcccaatgtattgtttgctgga tacaagctaccacatccattgcaatacaagatcattgtcaaggtgcaaaccaccagccag tcgtcaccgattcaagcgtacaacctggccctcagcgatctggacaaggagctggagcat ctcaagagagcattcgagagcgaagtagcacaaaggcagacggactactactga

DBGET integrated database retrieval system