Selaginella moellendorffii: SELMODRAFT_19615 Help Entry SELMODRAFT_19615  CDS       T01496                                  Name (RefSeq) hypothetical protein   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism smo  Selaginella moellendorffii Pathway smo03010   Ribosome smo04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:smo00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     SELMODRAFT_19615   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     SELMODRAFT_19615  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:smo03011]     SELMODRAFT_19615    04121 Ubiquitin system [BR:smo04121]     SELMODRAFT_19615 Ribosome [BR:smo03011]  Ribosomal proteins   Eukaryotes    Large subunit     SELMODRAFT_19615   Archaea     SELMODRAFT_19615 Ubiquitin system [BR:smo04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    SELMODRAFT_19615 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 Rad60-SLD_2 Plexin_RBD TBK1_ULD UBL_UBAC1 DUF2604 Ubiquitin_5 Dsc3_N OTU1_UBXL HATPase_c Motif Other DBs NCBI-GeneID:  9635532 NCBI-ProteinID:  XP_002979703 JGI:  19615 UniProt:  D8S8X4 LinkDB All DBs Position Unknown AA seq 78 aa AA seqDB search GAMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD YNIQKESTLHLVLRLRGG NT seq 234 nt NT seq  +upstreamnt  +downstreamnt ggagccatgcagatcttcgtcaagacattgaccggcaagaccatcactttggaggtcgag tcctcggatacgatcgacaatgtgaagaccaagatccaggacaaggagggcatccccccg gaccagcagcgcctcatcttcgcgggcaagcagctcgaggatgggcgcacgctcgcggac tacaacatccagaaggaatccacgctccacttggtgctgcgcctccgcggtggc

DBGET integrated database retrieval system