KEGG   Selaginella moellendorffii: SELMODRAFT_267058
Entry
SELMODRAFT_267058 CDS       T01496                                 
Symbol
HP1-1
Name
(RefSeq) histidine containing phosphotransfer protein
  KO
K14490  histidine-containing phosphotransfer peotein
Organism
smo  Selaginella moellendorffii
Pathway
smo04075  Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:smo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04075 Plant hormone signal transduction
    SELMODRAFT_267058 (HP1-1)
SSDB
Motif
Pfam: Hpt
Other DBs
NCBI-GeneID: 9652598
NCBI-ProteinID: XP_002966744
JGI: 267058
UniProt: D8R529
LinkDB
Position
Unknown
AA seq 151 aa
MDPGMLQRQYVELMQASFQENLLDDQFSQLQQLQDPTNPDFVAEVVSLFFEDSEKLLNDL
SKTFEHNPMNFKQIDAYVHQFKGSSASIGAARVKALCVAFRAYCEEENRDGCWQCLQQVK
REFFLVKTRLQALLQLEEKIIAAGGTVPLLE
NT seq 456 nt   +upstreamnt  +downstreamnt
atggatcccggaatgctgcagcgccagtatgtggagctgatgcaagcgtcgtttcaggag
aatctcctggacgatcagttctcgcaactccagcagctccaggatcccacaaatcccgac
ttcgtggccgaagtggtgtccttgttcttcgaggactcggaaaagctgctcaatgatttg
tcaaagacatttgagcacaatccgatgaacttcaagcagatcgatgcgtacgttcatcag
ttcaaggggagtagtgccagcattggagctgcccgtgtcaaggcattgtgcgttgctttt
cgtgcctactgcgaagaggaaaaccgggacggctgctggcaatgtctgcaacaagtaaag
cgcgaatttttccttgtcaagacgagactccaggcactgctccaactggaggagaagatc
attgctgccggtggcacagtcccgctgctcgaatga

DBGET integrated database retrieval system