Selaginella moellendorffii: SELMODRAFT_268541 Help Entry SELMODRAFT_268541 CDS       T01496                                  Name (RefSeq) hypothetical protein   KO K13113   ubiquitin-like protein 5 Organism smo  Selaginella moellendorffii Brite KEGG Orthology (KO) [BR:smo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:smo03041]     SELMODRAFT_268541   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:smo04052]     SELMODRAFT_268541 Spliceosome [BR:smo03041]  Complex B   Other components    Complex B specific factors     SELMODRAFT_268541 Cytokines and neuropeptides [BR:smo04052]  Neuropeptides   Unclassified    SELMODRAFT_268541 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Rad60-SLD Ubiquitin_4 OTU1_UBXL Crinkler Motif Other DBs NCBI-GeneID:  9635592 NCBI-ProteinID:  XP_002982045 JGI:  268541 UniProt:  D8R5K5 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MIEVILNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRPEKIRIQKWYTIYKDNITLSDY EIRDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggtgattctcaacgatcgtctgggcaagaaggtgagagtcaagtgcaacgag gatgataccatcggcgatttgaagaagctcgtggcggcgcagacggggacgcgcccggag aagatcaggatccagaaatggtacacgatctacaaggacaacatcactctgtccgattac gagatccgcgatggaatggggctggagctctactacaattaa

DBGET integrated database retrieval system