Selaginella moellendorffii: SELMODRAFT_271159 Help Entry SELMODRAFT_271159 CDS       T01496                                  Name (RefSeq) hypothetical protein   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism smo  Selaginella moellendorffii Pathway smo03060   Protein export smo04141   Protein processing in endoplasmic reticulum smo04145   Phagosome Brite KEGG Orthology (KO) [BR:smo00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     SELMODRAFT_271159    04141 Protein processing in endoplasmic reticulum     SELMODRAFT_271159  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     SELMODRAFT_271159  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:smo04131]     SELMODRAFT_271159   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:smo02044]     SELMODRAFT_271159 Membrane trafficking [BR:smo04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     SELMODRAFT_271159 Secretion system [BR:smo02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    SELMODRAFT_271159 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  SecE Motif Other DBs NCBI-GeneID:  9645448 NCBI-ProteinID:  XP_002975594 JGI:  271159 UniProt:  D8RRD8 LinkDB All DBs Position Unknown AA seq 69 aa AA seqDB search MEAVDVVVRPMKEFAKDSLRLVKRCHKPDRKEYTKVALRTAAGFVVMGFIGFFVKLIFIP INNIIVGSG NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggaggctgtggatgtggtcgtgcggccgatgaaggaattcgccaaggacagcctgcgg ctcgtcaagcgctgccacaagccggatcgcaaagagtataccaaggtcgcgctgaggaca gcggcgggattcgtagtgatgggattcatcggattcttcgtcaagctcatcttcatcccg atcaacaacatcatcgttggatcgggctag

DBGET integrated database retrieval system