Selaginella moellendorffii: SELMODRAFT_38954 Help Entry SELMODRAFT_38954  CDS       T01496                                  Name (RefSeq) hypothetical protein   KO K08336   ubiquitin-like protein ATG12 Organism smo  Selaginella moellendorffii Pathway smo04136   Autophagy - other Brite KEGG Orthology (KO) [BR:smo00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     SELMODRAFT_38954  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:smo04131]     SELMODRAFT_38954    04121 Ubiquitin system [BR:smo04121]     SELMODRAFT_38954    03029 Mitochondrial biogenesis [BR:smo03029]     SELMODRAFT_38954 Membrane trafficking [BR:smo04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     SELMODRAFT_38954 Ubiquitin system [BR:smo04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    SELMODRAFT_38954 Mitochondrial biogenesis [BR:smo03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     SELMODRAFT_38954 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  APG12 DUF7294 Motif Other DBs NCBI-GeneID:  9642526 NCBI-ProteinID:  XP_002971091 JGI:  38954 UniProt:  D8QRI3 LinkDB All DBs Position Unknown AA seq 86 aa AA seqDB search ALAVKVQFVSTGGAPVLIQSEFKIDATEKFAKVLKFLRRQVQQDNVFPFINQAFIPSQDE PVGDLYKNFGVHGKLIVNYAPTLAWG NT seq 261 nt NT seq  +upstreamnt  +downstreamnt gcgctcgcagtgaaggtccaattcgtttccacgggaggtgcgccagtgctgatccagtcg gaattcaagattgacgcgacggagaaattcgcgaaagttctcaagtttctgcggaggcaa gttcaacaggacaatgtgtttccattcatcaatcaagcatttattcccagccaagacgag cccgtgggagatctctataagaactttggcgtgcacgggaagctcatcgtaaactacgct cccactctggcgtggggctaa

DBGET integrated database retrieval system