Selaginella moellendorffii: SELMODRAFT_451215 Help Entry SELMODRAFT_451215 CDS       T01496                                  Symbol Rop2-2 Name (RefSeq) Rop2, RHO family GTPase   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism smo  Selaginella moellendorffii Pathway smo04145   Phagosome smo04148   Efferocytosis smo04620   Toll-like receptor signaling pathway smo05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:smo00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     SELMODRAFT_451215 (Rop2-2)    04148 Efferocytosis     SELMODRAFT_451215 (Rop2-2)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     SELMODRAFT_451215 (Rop2-2)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     SELMODRAFT_451215 (Rop2-2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:smo04131]     SELMODRAFT_451215 (Rop2-2)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:smo04147]     SELMODRAFT_451215 (Rop2-2)    04031 GTP-binding proteins [BR:smo04031]     SELMODRAFT_451215 (Rop2-2) Membrane trafficking [BR:smo04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     SELMODRAFT_451215 (Rop2-2)  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     SELMODRAFT_451215 (Rop2-2)   Macropinocytosis    Ras GTPases     SELMODRAFT_451215 (Rop2-2)  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     SELMODRAFT_451215 (Rop2-2) Exosome [BR:smo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    SELMODRAFT_451215 (Rop2-2)   Exosomal proteins of other body fluids (saliva and urine)    SELMODRAFT_451215 (Rop2-2)   Exosomal proteins of colorectal cancer cells    SELMODRAFT_451215 (Rop2-2)   Exosomal proteins of bladder cancer cells    SELMODRAFT_451215 (Rop2-2) GTP-binding proteins [BR:smo04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     SELMODRAFT_451215 (Rop2-2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Sua5_C Motif Other DBs NCBI-GeneID:  9651601 NCBI-ProteinID:  XP_002992192 JGI:  451215 UniProt:  D8T9D8 LinkDB All DBs Position Unknown AA seq 141 aa AA seqDB search LGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISRASYENISKKWIPELKHYAPTVPVIL VGTKLDLRDDKQFFADHPGATPITTVQGEELRKQIGAAAYIECSSKTQQNVKAVFDAAIK VVLQPPKQKKKKKKQKACTIL NT seq 426 nt NT seq  +upstreamnt  +downstreamnt ttgggtctctgggacaccgctggccaggaagactataacaggctgcgtccattgagttac cgaggagccgacgttttccttctagctttctcacttataagccgagctagctatgaaaac atttccaagaagtggattccagagctgaaacactacgccccgacggtgcctgtcattctc gttggcacgaagctggacttgcgagatgataagcagttttttgccgatcatccgggagcg acgcctattaccactgtccagggcgaagaactgaggaagcaaatcggtgctgctgcctac atcgagtgtagctcgaaaacccagcagaatgtaaaggcagtgtttgatgctgcgatcaag gtggtcctccaacctccaaagcagaagaaaaagaagaagaagcaaaaggcctgtacgata ctctag

DBGET integrated database retrieval system