Selaginella moellendorffii: SELMODRAFT_49471 Help Entry SELMODRAFT_49471  CDS       T01496                                  Name (RefSeq) hypothetical protein   KO K12897   transformer-2 protein Organism smo  Selaginella moellendorffii Pathway smo03040   Spliceosome Brite KEGG Orthology (KO) [BR:smo00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     SELMODRAFT_49471  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:smo01009]     SELMODRAFT_49471   09182 Protein families: genetic information processing    03041 Spliceosome [BR:smo03041]     SELMODRAFT_49471 Protein phosphatases and associated proteins [BR:smo01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      SELMODRAFT_49471 Spliceosome [BR:smo03041]  Common components   Common spliceosomal components    SR proteins     SELMODRAFT_49471 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RRM_1 RRM_5 RL SET_assoc Motif Other DBs NCBI-GeneID:  9644231 NCBI-ProteinID:  XP_002984383 JGI:  49471 UniProt:  D8SM58 LinkDB All DBs Position Unknown AA seq 78 aa AA seqDB search REDPDNPGNNLYVTGLSTRVAEKQLLEHLSREGKVLECRIVVDPRTKESRGFGFVTMAST EDAERCINYMNRSTLEGR NT seq 234 nt NT seq  +upstreamnt  +downstreamnt agggaggatcctgacaatccgggaaataacctctatgtcactggcctctcgacgcgggtc gcggagaagcagctcttggagcatctctcgcgagaggggaaggtcctggagtgtcggatc gtggtggatccgaggaccaaggagtccagagggtttggatttgtgacaatggccagtacg gaggatgcggagcgctgcatcaactatatgaatcgctccacgctcgagggccgt

DBGET integrated database retrieval system