Selaginella moellendorffii: SELMODRAFT_7118 Help Entry SELMODRAFT_7118   CDS       T01496                                  Name (RefSeq) hypothetical protein   KO K11252   histone H2B Organism smo  Selaginella moellendorffii Brite KEGG Orthology (KO) [BR:smo00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:smo03036]     SELMODRAFT_7118   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:smo04147]     SELMODRAFT_7118 Chromosome and associated proteins [BR:smo03036]  Eukaryotic type   Nucleosome assembly factors    Histones     SELMODRAFT_7118 Exosome [BR:smo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    SELMODRAFT_7118 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa FANCI_S3 Flu_NS1 DUF6734 Motif Other DBs NCBI-GeneID:  9654316 NCBI-ProteinID:  XP_002983130 JGI:  7118 UniProt:  D8SIA6 LinkDB All DBs Position Unknown AA seq 96 aa AA seqDB search KRKKAAASNTYKRYILKVLRSTTHEDLKISATAMDIMNTFMNDMFERLAREAAELVRRNK AATLSSKDIQTACKLALPGQLSQQAVVEGQRAVARF NT seq 288 nt NT seq  +upstreamnt  +downstreamnt aagcgaaagaaggcggcggcgagcaacacgtacaagcgctacatcctcaaggttttgcgg tcgacaacgcacgaggatctcaagatatcggccacggccatggatatcatgaacacgttc atgaacgacatgtttgagaggctggcgagagaggcggcggagctggtccggcgcaacaag gcggccacgctctcctccaaggacatccagaccgcctgcaagctcgccttgcccgggcag ctgtcccagcaagccgtcgtggagggccaaagggccgtggccagattt

DBGET integrated database retrieval system