Selaginella moellendorffii: SELMODRAFT_8199 Help Entry SELMODRAFT_8199   CDS       T01496                                  Name (RefSeq) hypothetical protein   KO K10420   dynein light chain Tctex-type 1/3 Organism smo  Selaginella moellendorffii Pathway smo04145   Phagocytosis smo04814   Motor proteins Brite KEGG Orthology (KO) [BR:smo00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     SELMODRAFT_8199   09142 Cell motility    04814 Motor proteins     SELMODRAFT_8199  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:smo03037]     SELMODRAFT_8199    04812 Cytoskeleton proteins [BR:smo04812]     SELMODRAFT_8199 Cilium and associated proteins [BR:smo03037]  Motile cilia and associated proteins   Dynein arm    SELMODRAFT_8199 Cytoskeleton proteins [BR:smo04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      SELMODRAFT_8199 SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 THAP9_C Motif Other DBs NCBI-GeneID:  9646060 NCBI-ProteinID:  XP_002970019 JGI:  8199 UniProt:  D8RFL6 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search IGQWTSTVCEKCMAKLVNLNKPFKYIVTCMIMQKNGAGLVTASSCFWDPLADGSRTMRWE NKTMYAIATAYAM NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atcggccaatggacatccacagtctgcgagaaatgcatggccaagctcgtaaatctaaac aagcccttcaagtatattgttacctgtatgatcatgcaaaagaacggcgctgggcttgtc acggcaagctcttgcttttgggatccactagccgacggtagccgtacgatgcgttgggag aacaagacaatgtacgccattgccacggcatacgccatg

DBGET integrated database retrieval system