Selaginella moellendorffii: SELMODRAFT_8800 Help Entry SELMODRAFT_8800   CDS       T01496                                  Name (RefSeq) hypothetical protein   KO K10419   dynein light chain roadblock-type Organism smo  Selaginella moellendorffii Pathway smo04814   Motor proteins Brite KEGG Orthology (KO) [BR:smo00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     SELMODRAFT_8800  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:smo04131]     SELMODRAFT_8800   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:smo03037]     SELMODRAFT_8800    04812 Cytoskeleton proteins [BR:smo04812]     SELMODRAFT_8800 Membrane trafficking [BR:smo04131]  Endosome - Golgi transport   Rab GTPases and associated proteins    Rab associated proteins     SELMODRAFT_8800 Cilium and associated proteins [BR:smo03037]  Motile cilia and associated proteins   Dynein arm    SELMODRAFT_8800 Cytoskeleton proteins [BR:smo04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      SELMODRAFT_8800 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Robl_LC7 Motif Other DBs NCBI-GeneID:  9650595 NCBI-ProteinID:  XP_002972258 JGI:  8800 UniProt:  D8RMI4 LinkDB All DBs Position Unknown AA seq 77 aa AA seqDB search VIGTMIVAANGNVLRTTLPQDLAFKYATKIPSLAAMARSGVRELDPQNDLQMLRIKTLLH EIIVIAEPLFTLLVVQN NT seq 231 nt NT seq  +upstreamnt  +downstreamnt gtgattggaacgatgattgtagcagcgaatggaaatgtattgcgaactacactgcctcag gatctggctttcaagtatgcgacgaagatcccgagcttggcagccatggctcgcagcggc gttcgcgagctcgacccccagaatgatctccagatgctgaggataaagacgctgctccac gagataattgtcatagccgagcctctgtttacgctcttggtggtccagaat

DBGET integrated database retrieval system