Selaginella moellendorffii: SELMODRAFT_99676 Help Entry SELMODRAFT_99676  CDS       T01496                                  Name (RefSeq) hypothetical protein   KO K10418   dynein light chain LC8-type Organism smo  Selaginella moellendorffii Pathway smo04814   Motor proteins Brite KEGG Orthology (KO) [BR:smo00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     SELMODRAFT_99676  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:smo03037]     SELMODRAFT_99676    04812 Cytoskeleton proteins [BR:smo04812]     SELMODRAFT_99676 Cilium and associated proteins [BR:smo03037]  Motile cilia and associated proteins   Dynein arm    SELMODRAFT_99676 Cytoskeleton proteins [BR:smo04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      SELMODRAFT_99676 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  9642626 NCBI-ProteinID:  XP_002973558 JGI:  99676 UniProt:  D8RRC3 LinkDB All DBs Position Unknown AA seq 94 aa AA seqDB search MKLKSVDMPPAIQQHAVECAFQLLKNMDCKLNCKLIAWQLKKEFDKIHGPAWHCIVGTSF GSYVTHSVGGFIYFAVGKVSILLFRTAIEVVDKK NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgaagctaaagtccgtggacatgcctccggcgatccagcagcacgccgtggagtgtgcc ttccagctcctcaagaacatggattgcaagctcaactgcaagctcatcgcctggcaactt aagaaggagtttgataagatccatggaccggcttggcactgcatcgtggggacgagtttt ggatcgtatgtaacgcactccgtcggtggattcatctactttgcggtgggaaaggtgtcg attcttctctttagaactgccatcgaggtggtggataaaaagtag

DBGET integrated database retrieval system