Streptomyces moderatus: POD33_14290 Help Entry POD33_14290       CDS       T10886                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism smod  Streptomyces moderatus Pathway smod00998   Biosynthesis of various antibiotics smod01100   Metabolic pathways smod01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:smod00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     POD33_14290    00074 Mycolic acid biosynthesis     POD33_14290   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     POD33_14290 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  WCH93223 LinkDB All DBs Position 3148629..3148880 Genome browser AA seq 83 aa AA seqDB search MTTVAPERLSRIREIIAENIDVDLDGLSDTALFIDELGADSLKLIDVLSALEMEYSIVID MNELPKMTNVEATYQVTAAAAGW NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgaccacggtcgcgcccgagcgcctctcccgcatccgggaaatcatcgccgagaacatc gacgtcgacctcgacgggctttccgacaccgccctgttcatcgacgaactcggcgccgac tcgctgaagctcatcgacgtcctcagcgccctggagatggagtactccatcgtcatcgac atgaacgaactgcccaagatgaccaacgtggaggccacttaccaggtgaccgccgcggcc gccggttggtga

DBGET integrated database retrieval system