Streptomyces moderatus: POD33_14425 Help Entry POD33_14425       CDS       T10886                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism smod  Streptomyces moderatus Pathway smod00253   Tetracycline biosynthesis smod01056   Biosynthesis of type II polyketide backbone smod01100   Metabolic pathways smod01110   Biosynthesis of secondary metabolites Module smod_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite KEGG Orthology (KO) [BR:smod00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     POD33_14425    00253 Tetracycline biosynthesis     POD33_14425  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:smod01004]     POD33_14425    01008 Polyketide biosynthesis proteins [BR:smod01008]     POD33_14425 Lipid biosynthesis proteins [BR:smod01004]  Polyketide synthase   Component type    POD33_14425 Polyketide biosynthesis proteins [BR:smod01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      POD33_14425     Nonaketide PKS      POD33_14425     Decaketide PKS      POD33_14425 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF2958 Motif Other DBs NCBI-ProteinID:  WCH93250 LinkDB All DBs Position 3176278..3176535 Genome browser AA seq 85 aa AA seqDB search MNITVEEIRRIIVASAGAPESGASDADFADTSFDELGYESLALMETASAIEREFGVSVPD DLLFEARTPRELAELVRSAKEAAAA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt gtgaacatcaccgtggaagagatccgccgcatcatcgtcgccagcgccggcgcccccgag tccggggcatccgacgccgacttcgccgacacctccttcgacgaactgggctacgagtcg ctggccctgatggagaccgcctccgcgatcgagcgcgagttcggcgtgtcggtgccggac gacctgctcttcgaggcccgtacgccgcgcgagctggccgaactggtccgctccgcgaag gaggccgcggccgcatga

DBGET integrated database retrieval system