Streptomyces moderatus: POD33_35555 Help Entry POD33_35555       CDS       T10886                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism smod  Streptomyces moderatus Pathway smod00998   Biosynthesis of various antibiotics smod01100   Metabolic pathways smod01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:smod00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     POD33_35555    00074 Mycolic acid biosynthesis     POD33_35555   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     POD33_35555 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  WCH97163 LinkDB All DBs Position 7861661..7861906 Genome browser AA seq 81 aa AA seqDB search MNRTEAMDMVKESLTRVIPGADVAALGPDDAFRDVLEMDSLDFLSFVEVLSERSGIRIED EDASRLVTLAASADFLVAVAR NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaaccgaaccgaggcaatggacatggtcaaggaatcgctcacccgtgtcatcccgggc gccgacgtcgccgcgctgggccccgacgacgcgttccgtgacgtgctggagatggattcg ctggacttcctgagtttcgtggaggtcctcagcgagcggtccggcatacgcatcgaggac gaggacgcgtcccggctcgtcacgctggctgccagcgccgacttccttgtcgccgtggcg cggtga

DBGET integrated database retrieval system