Spirosoma montaniterrae: AWR27_19000 Help Entry AWR27_19000       CDS       T04702                                  Name (GenBank) ATP synthase subunit epsilon   KO K02114   F-type H+-transporting ATPase subunit epsilon Organism smon  Spirosoma montaniterrae Pathway smon00190   Oxidative phosphorylation smon01100   Metabolic pathways Module smon_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:smon00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     AWR27_19000  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:smon00194]     AWR27_19000 Photosynthesis proteins [BR:smon00194]  Photosystem and electron transport system   F-type ATPase [OT]    AWR27_19000 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_DE_N DUF4402 Motif Other DBs NCBI-ProteinID:  AQG81223 UniProt:  A0A1P9X0V4 LinkDB All DBs Position 4460186..4460431 Genome browser AA seq 81 aa AA seqDB search MTLDIITPDRKVFSGEVSAVTFPGSQGQFQVLNDHAALVSTLAKGPIVVQSAAGQQTFTV DGGVVEVLQNKVLVLAEAVVA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgacgttagacattatcactccagaccgaaaggttttctcaggcgaagtcagcgcggtt acgtttccgggtagtcagggtcagtttcaggtgctgaacgatcacgcagcattagtaagt acgcttgccaaaggtccgattgtggtgcagagtgccgccggtcagcaaacgtttaccgta gatggtggcgtggtagaagtactgcaaaacaaagtgctggtactggccgaagccgttgtt gcttaa

DBGET integrated database retrieval system