Sphingomonas morindae: LHA26_01545 Help Entry LHA26_01545       CDS       T08557                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism smor  Sphingomonas morindae Pathway smor01100   Metabolic pathways smor01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:smor00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LHA26_01545    00074 Mycolic acid biosynthesis     LHA26_01545   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LHA26_01545 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF2827 Motif Other DBs NCBI-ProteinID:  USI73191 UniProt:  A0ABY4X936 LinkDB All DBs Position 1:320756..321004 Genome browser AA seq 82 aa AA seqDB search MTTRDQTFARVAELIEPFNKKGVPLAEQTRFATDLEWDSLTVMDFVAAVEDEFDILITMN MQAQIETVGQLVDAVDTLKAKA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgaccacgcgcgaccaaacctttgcccgggtggcggagctgatcgagcccttcaacaag aagggcgtgccgctcgccgaacagacccgcttcgccaccgatctggaatgggacagtctc acggtgatggacttcgtcgccgccgtggaggacgagttcgacattctgatcaccatgaac atgcaggcccagatcgaaaccgtgggccagctggtggatgcggtcgatacgctgaaggcc aaggcatga

DBGET integrated database retrieval system