Sphingomonas morindae: LHA26_07710
Help
Entry
LHA26_07710 CDS
T08557
Name
(GenBank) SulP family inorganic anion transporter
KO
K03321
sulfate permease, SulP family
Organism
smor
Sphingomonas morindae
Brite
KEGG Orthology (KO) [BR:
smor00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
smor02000
]
LHA26_07710
Transporters [BR:
smor02000
]
Other transporters
Electrochemical potential-driven transporters [TC:
2
]
LHA26_07710
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Sulfate_transp
STAS
STAS_2
MFS_MOT1
AAA_lid_2
Motif
Other DBs
NCBI-ProteinID:
USI74323
UniProt:
A0ABY4XBH4
LinkDB
All DBs
Position
1:1574682..1576181
Genome browser
AA seq
499 aa
AA seq
DB search
MSSVLSAYRRQWFTTGDAARRDGLAGLVVALALIPEAIGFSIIAGVDPRVGLYASVAIAM
TSALLGGRPAMISAATAAVAVLVGPLVRDHGLSYLFAATLLMGLIQIAAGLARLDLLMRF
VSRSVITGFVNALAILILLAQLPQLVHVGWQTYALVAAGLAIIYGLPRLTRAVPSPLVAI
LVLSAISIGLGLPVRTVGDMGRLPEGLPSFALPQLPLTLETLRIILPYAGAMAAVGLLES
LLTAQIVDDMTGTDSDKRQECMGQGTANIVAALFGGMGGCAMIGQSVINVTSGGRNRLST
FVAGGFLLFLLAVLGPWVGRVPMPALVAVMIMVSIGTFSWTSIPNLVRHPPSSSAVMLVT
VVVVVATRDLSLGVLAGVLLSGLFFAGKVQRLVTVETMAAAAPGEAALVRISGQIFFASV
DRVTRAFRHEIAAERIVIDLTDAHIWDISGVGALDAIIARLRRAGRSVEVIGYNRASADL
VERFALHDKTGVELGLAPH
NT seq
1500 nt
NT seq
+upstream
nt +downstream
nt
atgtcctctgttctctccgcctatcgtcgccagtggttcaccaccggcgacgccgcccgc
cgcgatggtctggccgggcttgtcgtcgcgctcgcgctcatccccgaggcgatcggcttt
tccatcatcgccggcgtcgatccccgcgtcggcctctacgcctccgtcgccatcgccatg
acgagcgcgctgctcggcggccggcccgccatgatctccgccgccaccgccgccgtggcg
gtgctggtcggcccgctggtgcgcgatcacggcctctcctacctgttcgccgccacgctt
ctgatggggctgatccagatcgccgcggggctggcgcggctcgatctgctgatgcggttc
gtctcgcgctcggtcatcaccggcttcgtcaacgcgctcgccattctcatcctgctcgcg
cagctgccgcagctcgtgcatgtcggctggcagacctatgcgctggtcgcggccgggctg
gcgatcatctacggcctgccccgtctcacccgggccgtgccttcgccgctggtggcgatc
ctcgtgctgagcgcgatcagcatcggcctggggcttcccgtccgcaccgtcggcgatatg
ggccggctccccgagggtctgcccagcttcgccctgccgcagctgccgctgacgctggag
acgctgcgcatcatcctgccctatgccggcgcgatggcggcggtggggctgctcgaatcc
ttgctgaccgcgcagatcgtcgacgacatgaccggcaccgacagcgacaagcgccaggaa
tgcatgggccagggcaccgccaacatcgtcgccgcgctgttcggcggcatgggcggctgc
gcgatgatcggccagtcggtgatcaacgtcacctcgggcgggcgcaaccgcctctccacc
ttcgtcgcgggcggctttctgcttttcctgctggcggtgctgggcccatgggtaggccgc
gtgccgatgcccgcgctggtggcggtgatgatcatggtctcgatcggcactttcagctgg
acctcgatccccaacctcgtccgccatccgccaagctcgtcggcggtgatgctggtcacc
gtcgtggtggtggtggccacgcgcgatctctcgctgggcgtgctggcgggggtgctgctg
tccggcctgttcttcgcgggcaaggtgcagcggctggtgacggtggagacgatggccgcc
gccgcgccgggcgaggcggcgctggtccggatcagcggccagatcttcttcgcctcagtc
gaccgcgtgacgcgcgcctttcgccacgagatcgcggcggagcggatcgtcatcgatctg
accgacgcgcatatctgggacatttccggggtcggcgcgctcgacgcgatcatcgcccga
ctgcgccgcgccggccgctcggtggaggtgatcggctataaccgcgccagcgccgatctg
gtcgagcgcttcgcgctgcacgacaagaccggggtcgagctgggcctcgcgccgcactga
DBGET
integrated database retrieval system