KEGG   Sphingomonas morindae: LHA26_09355
Entry
LHA26_09355       CDS       T08557                                 
Symbol
trbJ
Name
(GenBank) P-type conjugative transfer protein TrbJ
  KO
K20266  type IV secretion system protein TrbJ
Organism
smor  Sphingomonas morindae
Pathway
smor02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:smor00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    LHA26_09355 (trbJ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:smor02044]
    LHA26_09355 (trbJ)
Secretion system [BR:smor02044]
 Type IV secretion system
  Trb secretion system protein
   LHA26_09355 (trbJ)
SSDB
Motif
Pfam: DUF3535 Hypoth_Ymh DUF948 Mod_r Tweety DUF4141 DUF3410 CHASE8 DUF5929 FapA
Other DBs
NCBI-ProteinID: USI71546
UniProt: A0ABY4X3V5
LinkDB
Position
1:1915920..1916678
AA seq 252 aa
MIPRRSRAARLAAALLIAPVLVAPMLATPAQAIIVFDPSNYAQNVLQAARALQQINQQIT
SLQNQSQMLMNQARNLASLPYSSLQQLQQSVSRTQQLLSQAQTIAYDVRSIDQAFQQKYG
SVSLSATDAQLVADARSRWQTTVGGLQDAMRVQAGVVGNIDTNRAEMASLVTRSQAATGA
LQATQAGNQLLALQAQQLADLTAVVAANGRAQALHDAEQATAAEQGREQRRRFLTPGTGY
QPGNAQMFYGRN
NT seq 759 nt   +upstreamnt  +downstreamnt
atgattccgcgccgttcccgcgcggcgcggcttgctgccgcgctgctcatcgctcccgtg
ctggtcgcgccgatgctcgcgacgccggcacaggccatcatcgtatttgatccgtccaac
tacgcgcagaacgtccttcaggccgcccgcgcgcttcagcagatcaaccaacagatcacg
tcgctccagaaccagtcgcagatgctgatgaaccaggcccgcaacctcgcgagcctgcct
tactcctctctccagcagctccagcagtcggtcagccgcacccagcagcttctctcccag
gcgcagaccatcgcctacgacgtgcgctcgatcgatcaggctttccaacagaagtacggc
agcgtctcgctctcggcgaccgacgcgcagctcgtcgccgacgcccgttcgcgctggcag
acgacggtcggcggcttgcaggatgcgatgcgcgtgcaggccggggtcgtcggcaacatc
gacaccaaccgagcggagatggcgagcttggtcacccgctcgcaggcggcgaccggcgcc
ttgcaggcgacgcaggccggcaaccagctcctcgcgctccaggcgcagcagctcgccgac
ctcaccgccgtcgtcgccgccaacggccgcgcgcaggcgctgcacgacgccgaacaggcg
accgccgccgagcagggccgcgagcagcgccgccgcttcctgacgccgggcacgggctac
cagcccggcaacgcgcagatgttctacggccgcaactga

DBGET integrated database retrieval system