KEGG   Sphingomonas morindae: LHA26_13260
Entry
LHA26_13260       CDS       T08557                                 
Symbol
petA
Name
(GenBank) ubiquinol-cytochrome c reductase iron-sulfur subunit
  KO
K00411  ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:7.1.1.8]
Organism
smor  Sphingomonas morindae
Pathway
smor00190  Oxidative phosphorylation
smor01100  Metabolic pathways
smor02020  Two-component system
smor04148  Efferocytosis
Module
smor_M00151  Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:smor00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    LHA26_13260 (petA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LHA26_13260 (petA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04148 Efferocytosis
    LHA26_13260 (petA)
Enzymes [BR:smor01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.8  quinol---cytochrome-c reductase
     LHA26_13260 (petA)
SSDB
Motif
Pfam: UCR_Fe-S_N Rieske
Other DBs
NCBI-ProteinID: USI72255
UniProt: A0ABY4X604
LinkDB
Position
1:2702634..2703227
AA seq 197 aa
MATRDTVDDPNQRPPVIAGPHEDGVGPRRRDFLNIAAVSFAGVGAATVLIPLVNQMNPSA
DVLALASTEVDLAKVVPGQGIKVSWRKQPVFIRNLTPKEIAEADAVPLSSLRDPQTLAER
TKPGHKNWLITLGVCTHLGCVPLGISEGENRGQYGGYFCPCHGSQYDTAARIRGGPAPRN
LAVPDYAFKTPTTVQIG
NT seq 594 nt   +upstreamnt  +downstreamnt
atggcaacacgtgataccgtggacgatcccaaccaaaggccgccggtcatcgccggcccg
cacgaagacggcgtcgggccgcgccgccgcgatttcctgaacatcgccgccgtgagcttc
gccggcgtcggcgcggcgaccgtgctgatcccgctcgtcaaccagatgaacccctcggcc
gatgtgctggcgctcgcctcgaccgaggtggatctcgccaaggtcgtgcccggccagggc
atcaaggtctcctggcgcaagcagcccgtgttcatccgcaatctcacgcccaaggagatc
gccgaggcggacgcggtgccgctgtccagcctgcgcgatccccagacgctcgcggagcgc
accaagcccggccacaagaactggctgatcacgctgggcgtctgcacccatctcggctgc
gtgccgctgggcatctcggagggcgagaatcgcggccaatatggcggctatttctgcccc
tgccatggctcgcaatatgacaccgccgcgcgcattcgcggcgggccggcgccgcgcaac
ctggcggtgccggactatgccttcaaaacgcccaccaccgtgcagatcggctga

DBGET integrated database retrieval system