KEGG   Sphingomonas morindae: LHA26_18770
Entry
LHA26_18770       CDS       T08557                                 
Symbol
kdpB
Name
(GenBank) potassium-transporting ATPase subunit KdpB
  KO
K01547  potassium-transporting ATPase ATP-binding subunit [EC:7.2.2.6]
Organism
smor  Sphingomonas morindae
Pathway
smor02020  Two-component system
Brite
KEGG Orthology (KO) [BR:smor00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LHA26_18770 (kdpB)
Enzymes [BR:smor01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.6  P-type K+ transporter
     LHA26_18770 (kdpB)
SSDB
Motif
Pfam: E1-E2_ATPase Hydrolase HAD Hydrolase_3
Other DBs
NCBI-ProteinID: USI74792
UniProt: A0ABY4XCV4
LinkDB
Position
2:complement(466643..468673)
AA seq 676 aa
MARTSQSLFTSALMLPAAADAVRKLDPRQLVRNPVMFTTAVVAALLTLLLLVGHDGLGTG
FKLQLVIWLWLTVLFGTFAEALAEGRGKAQAASLRATKAELSAKRLRASGGLEPVPASAL
RLGDVVLVETGDLIPSDGEVIEGVASVNEAAITGESAPVIREAGGDRSAVTAGTRVLSDQ
IKVRVTVNPGQGFLDRMIALVEGAERQKTPNEIALTLLLVGLTIIFLIAVATVPGFAAYA
GGSIPVAILAALLITLIPTTIAALLSAIGIAGMDRLVRFNVLAKSGRAVEAAGDVDVLLL
DKTGTITIGDRQASLFRPVDGTLEAELAEAALLASLADETPEGRSIVALARQQHLVQTTV
LPAGSEIIPFTAQTRISGVRAGGVLIQKGAVDSILRAHPGLGQTAAATELRRITDEIARA
GGTPLAVARDGRLLGAIFLKDVVKAGIRERFGALRQMGIRTVMITGDNPLTAAAIAAEAG
VDDFLAQATPEDKLALIRDEQRGGRLVAMCGDGTNDAPALAQADVGVAMNTGTQAAREAG
NMVDLDSDPTKLIEIVGLGKQLLMTRGALTTFSVANDVAKYFAIIPAMFVALYPGLAVLN
VMRLATPESAILSAIIFNALIIPLLVPLALRGVAYRPMGAGPLLARNLAVYGLGGLIAPF
VGIKLIDLAVTGLGLA
NT seq 2031 nt   +upstreamnt  +downstreamnt
atggcccgcacgtcccaatctctgttcacctcggcgctgatgctgccggcggcggccgat
gccgtccgcaagctcgatccgcgccagctcgtccgcaacccggtgatgttcaccaccgcc
gtggtggcggccttgctcaccctgctgctgctcgtcggccatgacgggctgggcaccggc
ttcaagctccagctggtgatctggctgtggctgacggtgctgttcggcaccttcgccgag
gcgctcgccgaggggcggggcaaggcgcaggccgcctcgctgcgcgccaccaaggccgag
ctttcggccaagaggctgcgggcctcgggcgggctcgagccggtgcccgccagcgcgctg
cggctgggcgatgtggtgctggtggaaaccggcgatctcatcccctcggacggcgaggtg
atcgagggcgtcgcctcggtcaacgaggcggcgatcaccggcgaaagcgcgcccgtgatc
cgcgaggccggcggcgaccgctcggcggtgacggcgggcacgcgcgtgctgtcggatcag
atcaaggtccgcgtcaccgtcaatcccggccagggctttctcgatcgcatgatcgcgctg
gtcgagggcgcggagcggcagaagacgcccaacgagatcgcgctcaccctgttgctggtg
ggactgacgatcatcttcctgatcgcggtggcgacggtgccgggcttcgccgcctatgcc
ggcggcagcatcccggtggcgatcctggcggcgctgctcatcaccctcatccccaccacg
atcgccgcgctgctctcggcgatcggcatcgccggcatggaccggctggtgcgcttcaac
gtgctcgccaaatcgggccgcgcggtggaggcggcgggcgatgtcgatgtgctgctgctc
gacaagaccggcacgatcacgatcggcgatcgccaggcgtcgctgttccggccggtggac
ggcacgctcgaggccgagctggccgaggcggcgctgctcgccagcctcgccgacgagacg
cccgagggccgctcgatcgtggcgctggcgcgccagcagcatctcgtgcagaccacggtg
ctgccggcggggagcgagatcatccccttcaccgcgcagacgcgcatttccggcgtgcgc
gccggcggcgtgctgatccagaagggcgcggtggattcgatcctgcgcgcgcatccgggc
ctcggccagaccgccgccgccaccgagctgcgccggatcacggacgagatcgcgcgcgcc
ggcggcacgccactcgcggtggcgcgcgacggccggctgctcggcgcgatcttcctcaag
gatgtcgtcaaggcgggcattcgcgagcggttcggcgcgctgcgccagatgggcatccgc
acggttatgatcaccggcgacaatccgctcaccgccgcggcgatcgccgccgaggcgggg
gttgacgatttcctcgcccaggccaccccggaggacaagttggcgctgatccgcgacgag
cagcgcggcggccggctggtggcgatgtgcggcgacggcaccaacgacgcgcccgcgctc
gcccaggcggatgtcggcgtggcgatgaacaccggcacccaggccgcgcgcgaggccggc
aacatggtggatctcgacagcgacccgaccaagctgatcgagatcgtggggctcggcaaa
cagctgctgatgacgcgcggcgcgctcaccaccttctcggtggccaatgacgtcgccaaa
tatttcgccatcatcccggcgatgttcgtggccctgtatcccggcctggcggtgctcaac
gtgatgcggctggccacgcccgagagcgcgatcctgtccgcgatcatcttcaacgcgctc
atcatcccgctgctggtgccgctggcgctgcgcggcgtcgcctatcggccgatgggggcg
gggccgctgctggcgcgcaatctcgccgtctacggcctgggcggactcatcgcgccgttt
gtcggcatcaagctcatcgacctcgccgtcaccggcctcggtctcgcctga

DBGET integrated database retrieval system