Sinorhizobium meliloti BL225C: SinmeB_0767 Help Entry SinmeB_0767       CDS       T01884                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism smq  Sinorhizobium meliloti BL225C Pathway smq01100   Metabolic pathways smq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:smq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SinmeB_0767    00074 Mycolic acid biosynthesis     SinmeB_0767   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SinmeB_0767 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Delta_lysin Motif Other DBs NCBI-ProteinID:  AEG03701 LinkDB All DBs Position 807232..807468 Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVIDHLGVDAEKVSEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA DSILTVGDAVKFIEKAQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgcagaacgcgtgaagaaaattgttattgatcatcttggcgtcgacgcc gaaaaggtcagcgaaggcgcaagcttcatcgatgacctcggcgcggactcgctcgacacc gtcgaactggtcatggcattcgaagaggaattcggtgtcgaaatcccggacgacgcagca gattcgatcctcaccgttggcgacgccgtcaagttcatcgagaaagcccaggcctga

DBGET integrated database retrieval system