Sinorhizobium meliloti BL225C: SinmeB_4076 Help Entry SinmeB_4076       CDS       T01884                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism smq  Sinorhizobium meliloti BL225C Pathway smq01100   Metabolic pathways smq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:smq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SinmeB_4076    00074 Mycolic acid biosynthesis     SinmeB_4076   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SinmeB_4076 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  AEG08371 LinkDB All DBs Position pSINMEB02:679186..679437 Genome browser AA seq 83 aa AA seqDB search MSDHQLYLSQIADVIRELFDEYDGPITLETTARDVPQWDSLSNVRLMVLIEQELAVRFST AEVQGFKNLGSLIDAVVKRKQNQ NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgtctgaccatcaactttatctatcccaaatcgcagacgtgatccgtgagctgttcgat gaatacgacgggcccattacgctggagacgacggcccgcgacgttccgcaatgggacagc ctgtccaatgtcagactgatggttctgatcgagcaggagctcgcagtccgcttcagcacg gcggaggtgcaaggtttcaagaacctcggcagccttatcgatgccgtggtcaagcgcaag cagaaccaatag

DBGET integrated database retrieval system