Sinorhizobium meliloti BL225C: SinmeB_5274 Help Entry SinmeB_5274       CDS       T01884                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism smq  Sinorhizobium meliloti BL225C Pathway smq01100   Metabolic pathways smq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:smq00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SinmeB_5274    00074 Mycolic acid biosynthesis     SinmeB_5274   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SinmeB_5274 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AEG06541 LinkDB All DBs Position pSINMEB01:193924..194175 Genome browser AA seq 83 aa AA seqDB search MEKSSADVSNRIRAIIVEQLGVDPAHAVDDASLVDDLGADFLEVAQIVMMIQDEFNIELS DDVAEAVITVGDAIYVVTSKTKS NT seq 252 nt NT seq  +upstreamnt  +downstreamnt gtggaaaaatccagcgcggacgtctcgaaccgtataagagcaataatcgtcgagcagttg ggcgtcgaccctgcccatgctgtggacgacgcgtctctggtcgatgacctcggcgccgac tttctcgaagtcgctcaaatcgtcatgatgattcaggacgagttcaatatcgaactttca gatgacgtggcggaggccgtgatcacggtcggagatgcaatttacgtggttacgtcgaaa accaagagctag

DBGET integrated database retrieval system