Staphylothermus marinus: Smar_0837 Help Entry Smar_0837         CDS       T00485                                  Name (GenBank) Ribosomal protein S27a   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism smr  Staphylothermus marinus Pathway smr03010   Ribosome Brite KEGG Orthology (KO) [BR:smr00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Smar_0837   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Smar_0837  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:smr03011]     Smar_0837    04121 Ubiquitin system [BR:smr04121]     Smar_0837   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:smr04147]     Smar_0837 Ribosome [BR:smr03011]  Ribosomal proteins   Eukaryotes    Small subunit     Smar_0837   Archaea     Smar_0837 Ubiquitin system [BR:smr04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Smar_0837 Exosome [BR:smr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Smar_0837   Exosomal proteins of colorectal cancer cells    Smar_0837 SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 Cas12f1-like_TNB Zn_ribbon_RPB9 Zn_ribbon_Nudix Zn_ribbon_IS1595 Zn_ribbon_3 IBR Zn_ribbon_PriA DUF7479 Zn_Ribbon_1 TackOD1 Ribosomal_L37ae EDR4-like_1st DZR Zn_ribbon_recom DUF1451 Baculo_ME53 A2L_zn_ribbon Zn_ribbon_TOP3B Lar_restr_allev Zn_ribbon_TFIIB zf_UBZ Motif Other DBs NCBI-ProteinID:  ABN69938 UniProt:  A3DMS8 LinkDB All DBs Position 828116..828280 Genome browser AA seq 54 aa AA seqDB search MAHVHKLYIFDYKTGTIKPKNKKCPKCGSFMAFHKKPVPRWHCGKCGYVEYVHE NT seq 165 nt NT seq  +upstreamnt  +downstreamnt atggcacatgttcacaaactctatatattcgactataaaaccgggacaataaagcctaaa aacaagaaatgccctaaatgcggtagctttatggcgttccataagaagcctgtgcctaga tggcattgtggcaaatgtggatacgtagaatatgtacatgaataa

DBGET integrated database retrieval system