Stenotrophomonas maltophilia R551-3: Smal_3279 Help Entry Smal_3279         CDS       T00733                                  Name (GenBank) conserved hypothetical protein   KO K09892   cell division protein ZapB Organism smt  Stenotrophomonas maltophilia R551-3 Brite KEGG Orthology (KO) [BR:smt00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:smt03036]     Smal_3279 Chromosome and associated proteins [BR:smt03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     Smal_3279 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB Taxilin Mod_r Stathmin YabA bZIP_1 FAZ1_C DUF3450 NRBF2 UPF0449 bZIP_2 GIT_CC Motif Other DBs NCBI-ProteinID:  ACF52978 UniProt:  B4SI14 LinkDB All DBs Position 3684561..3684782 Genome browser AA seq 73 aa AA seqDB search MEPADPLAQLQDFAARVEALLERNQRLAEENRSLRHQQEQLVAERSTLLAKNEQARSRVE AMISRLKSLEQHT NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atggaacccgccgatccccttgcccagctgcaggacttcgccgcccgcgtggaagcgttg cttgaacgcaaccagcggctggccgaggagaaccgcagcctgcgccatcagcaggaacaa ctggtggccgagcgctccacgctgctggccaagaacgaacaggcgcgctcgcgggtggaa gcaatgatcagccggctcaaatccctggagcagcacacatga

DBGET integrated database retrieval system