Stenotrophomonas maltophilia R551-3: Smal_3923 Help Entry Smal_3923         CDS       T00733                                  Name (GenBank) acyl carrier protein, putative   KO K02078   acyl carrier protein Organism smt  Stenotrophomonas maltophilia R551-3 Pathway smt01100   Metabolic pathways smt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:smt00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Smal_3923    00074 Mycolic acid biosynthesis     Smal_3923   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Smal_3923 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ACF53622 UniProt:  B4SN13 LinkDB All DBs Position complement(4417787..4418044) Genome browser AA seq 85 aa AA seqDB search MQALEHEIKELIISSLSLEDITPEDIDPTAPLFVEGLGLDSIDALELGLALQKKYGVSLS ADSEETRRHFSSVRALGEFVAARQS NT seq 258 nt NT seq  +upstreamnt  +downstreamnt gtgcaagcacttgagcacgagatcaaggaattgatcatttcctccctttcgctggaggac atcacgccggaggacatcgatccgaccgccccactgttcgtcgagggtctcggcctggat tcgatcgacgcgctggagctgggcctggcgctgcagaagaagtacggtgtgagcctctcg gccgattcggaagaaacccgtcgccatttctccagcgtgcgcgcgctcggcgagttcgtc gccgcccgccagtcgtaa

DBGET integrated database retrieval system