Skermanella mucosa: JL100_007520 Help Entry JL100_007520      CDS       T07652                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism smuc  Skermanella mucosa Pathway smuc01100   Metabolic pathways smuc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:smuc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JL100_007520    00074 Mycolic acid biosynthesis     JL100_007520   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JL100_007520 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N TRI4_N Motif Other DBs NCBI-ProteinID:  UEM22589 LinkDB All DBs Position SKMUc:1641489..1641728 Genome browser AA seq 79 aa AA seqDB search MSDIADRVKKIVIEHLGVEESKVTENASFIDDLGADSLDTVELVMAFEEEFGCEIPDDAA EKILTVKDAIDFIKANAAA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagtgacatcgccgatcgcgtgaagaagatcgtcatcgaacacttgggcgtcgaagag tccaaggtcaccgaaaatgccagcttcatcgacgatctgggcgccgacagcctggacacg gtcgagctggtgatggcgttcgaagaagagttcgggtgcgagatccccgacgacgccgcc gagaagatcctgaccgtcaaggacgcgatcgatttcatcaaggcgaacgccgcggcctga

DBGET integrated database retrieval system