Sulfurospirillum multivorans: SMUL_1354 Help Entry SMUL_1354         CDS       T03049                                  Name (GenBank) hypothetical protein   KO K03048   DNA-directed RNA polymerase subunit delta Organism smul  Sulfurospirillum multivorans Pathway smul03020   RNA polymerase Brite KEGG Orthology (KO) [BR:smul00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     SMUL_1354  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:smul03021]     SMUL_1354    03400 DNA repair and recombination proteins [BR:smul03400]     SMUL_1354 Transcription machinery [BR:smul03021]  Prokaryotic type   Bacterial type    RNA polymerase     Core subunits      SMUL_1354 DNA repair and recombination proteins [BR:smul03400]  Prokaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase complex (RNAP)       SMUL_1354 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  AHJ12615 UniProt:  A0AA86DZM2 LinkDB All DBs Position complement(1312804..1313109) Genome browser AA seq 101 aa AA seqDB search MRDLKELLLESGCSSEFILEAMRFEHLFTGDVDAFLDKVEDILMNEEDYEEELEDEDDED FDEEEDDPIYQSDYNYDGNEDNIYFEDEDGEEAFEDDEDEE NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgcgtgacttgaaagaacttcttttagagagcggttgctccagcgaatttatcctcgag gcgatgcgttttgagcatctctttaccggagatgtcgatgcgtttcttgacaaagttgaa gatattttaatgaacgaagaggactatgaagaagagctagaagacgaagacgatgaagat tttgatgaagaggaagacgatccgatttatcaaagtgactacaattacgatggcaatgaa gacaacatctactttgaagatgaagacggtgaagaggcttttgaagatgacgaggatgaa gagtaa

DBGET integrated database retrieval system