Sulfurospirillum multivorans: SMUL_2527 Help Entry SMUL_2527         CDS       T03049                                  Name (GenBank) acyl carrier protein AcpP   KO K02078   acyl carrier protein Organism smul  Sulfurospirillum multivorans Pathway smul01100   Metabolic pathways smul01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:smul00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SMUL_2527    00074 Mycolic acid biosynthesis     SMUL_2527   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SMUL_2527 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Motif Other DBs NCBI-ProteinID:  AHJ13772 UniProt:  A0AA86AQ08 LinkDB All DBs Position complement(2436283..2436513) Genome browser AA seq 76 aa AA seqDB search MALFDDVKAVVVEQLNVNPDEVKEDSKFVEDLGADSLDVVELVMALEEKFDIEIPDTDAE KIVTVKDAMSYIEAHK NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggcactatttgatgatgtaaaagcggtggttgttgaacaattaaatgtaaatcctgac gaggtaaaagaagattctaaattcgtagaagatttgggcgcagattctttggatgttgta gagctcgttatggcactcgaagagaaattcgacattgaaattccagacactgacgctgaa aaaatcgttacggtcaaagatgctatgtcttacattgaagcacataaataa

DBGET integrated database retrieval system