Sulfurospirillum multivorans: SMUL_2925 Help Entry SMUL_2925         CDS       T03049                                  Name (GenBank) hot_dog super family protein   KO K02372   3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59] Organism smul  Sulfurospirillum multivorans Pathway smul00061   Fatty acid biosynthesis smul00780   Biotin metabolism smul01100   Metabolic pathways smul01212   Fatty acid metabolism smul01240   Biosynthesis of cofactors Module smul_M00083   Fatty acid biosynthesis, elongation Brite KEGG Orthology (KO) [BR:smul00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SMUL_2925   09108 Metabolism of cofactors and vitamins    00780 Biotin metabolism     SMUL_2925  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:smul01004]     SMUL_2925 Enzymes [BR:smul01000]  4. Lyases   4.2  Carbon-oxygen lyases    4.2.1  Hydro-lyases     4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase      SMUL_2925 Lipid biosynthesis proteins [BR:smul01004]  Fatty acid synthase   Component type    SMUL_2925 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FabA Motif Other DBs NCBI-ProteinID:  AHJ14161 UniProt:  A0AA86ANU6 LinkDB All DBs Position 2810196..2810510 Genome browser AA seq 104 aa AA seqDB search MILNDFYTLIYKEETRFCVRLSDATHPIFQAHFPTNPIVAGFVLLDMSAEILGIEIVKIT KAKFLKHIAPLSVLWFDLQTTGNTLKIRVSQNEQKVAELTYEKR NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgattttaaatgatttttatacgcttatatataaagaggaaacgcgcttttgtgttagg ctaagtgacgcaacccatcctatttttcaagcgcattttccgacaaatcctattgttgct gggtttgttttactggatatgagtgctgagattttaggtatcgagatagtaaagatcaca aaagcaaaattcttgaaacatatcgcccctttgagtgtactgtggtttgatctccaaacg acgggcaacacactcaaaatccgtgtcagtcaaaatgagcagaaagtagcagaactcacc tatgaaaaaagatga

DBGET integrated database retrieval system