Simonsiella muelleri: BWP33_04485 Help Entry BWP33_04485       CDS       T05344                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism smur  Simonsiella muelleri Pathway smur01100   Metabolic pathways smur01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:smur00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BWP33_04485    00074 Mycolic acid biosynthesis     BWP33_04485   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BWP33_04485 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 DUF7080 DUF1493 Motif Other DBs NCBI-ProteinID:  AUX61138 LinkDB All DBs Position complement(917966..918202) Genome browser AA seq 78 aa AA seqDB search MMSIEQQVKDIVAEQLGVSIDEVKNESSFQDDLGADSLDTVELVMALEEAFGCEIPDEDA EKITTVQAAIDYVNAKQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt attatgtcaattgaacaacaagttaaagatatcgtcgctgaacaattgggcgtttctatt gatgaagtaaaaaacgaatcttctttccaagatgatttgggcgcagattctttggatacc gtagaattggtaatggctttggaagaagcattcggttgcgaaatccctgacgaagatgca gaaaaaatcacaactgttcaagctgcgattgattatgtaaacgctaaacaagcctaa

DBGET integrated database retrieval system