Simonsiella muelleri: BWP33_09670 Help Entry BWP33_09670       CDS       T05344                                  Name (GenBank) cell division protein FtsB   KO K05589   cell division protein FtsB Organism smur  Simonsiella muelleri Brite KEGG Orthology (KO) [BR:smur00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:smur03036]     BWP33_09670 Chromosome and associated proteins [BR:smur03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     BWP33_09670 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC HALZ DUF3450 SHE3 DUF7801 OVT1 bZIP_1 IFT20 Spc7 YabA TMF_TATA_bd DUF2570 Uso1_p115_C UPF0449 Pup KASH_CCD DUF4446 DUF349 ZapB HalX DUF4407 DUF5320 DUF2746 Motif Other DBs NCBI-ProteinID:  AUX62038 UniProt:  V9HDD7 LinkDB All DBs Position complement(1933302..1933571) Genome browser AA seq 89 aa AA seqDB search MKYISIVLTVVFLGLQYQIWFHNGGLRNQYETMKQKAEAADAQNQALVERNEALKAEVDD LKNSYDAVTEIARNQLHYIQSGETFYKIQ NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgaaatatatttccatcgtattaacagttgtgtttttgggtttacaataccaaatttgg tttcacaacggcggattgcgcaatcaatacgaaaccatgaaacaaaaagccgaagccgcc gatgcacaaaatcaagctttggtggaacgaaatgaagcactcaaagccgaagttgatgat ttgaaaaacagctatgatgcggttactgaaattgcacgtaatcaacttcactatattcaa tctggcgaaactttttataaaattcaataa

DBGET integrated database retrieval system