Simonsiella muelleri: BWP33_10015 Help Entry BWP33_10015       CDS       T05344                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism smur  Simonsiella muelleri Pathway smur01100   Metabolic pathways smur01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:smur00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BWP33_10015    00074 Mycolic acid biosynthesis     BWP33_10015   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BWP33_10015 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding GRIN_C Hymenoptaecin Motif Other DBs NCBI-ProteinID:  AUX62102 UniProt:  V9H915 LinkDB All DBs Position complement(2001772..2002032) Genome browser AA seq 86 aa AA seqDB search MSNLNQEIKELIISSLDLEDITAADIDDHAPLFSDDGLGLDSVDALELGLAIQKHFGFQL DKENTALRDSFQSVATLAEFVQKMKG NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgagcaatttaaatcaagaaatcaaagaattaattatcagcagtttggatttggaagac atcaccgctgctgatattgatgatcacgcgcctttatttagtgatgacggtttgggtttg gatagcgtggacgcattggagttgggtttggcaattcaaaagcatttcggttttcaattg gataaagagaataccgctttgcgcgacagttttcaaagtgttgccacgctcgccgaattc gtacaaaaaatgaaaggataa

DBGET integrated database retrieval system