KEGG   Streptococcus mutans GS-5 (serotype c): SMUGS5_05285
Entry
SMUGS5_05285      CDS       T02185                                 
Name
(GenBank) putative transglycosylase associated protein
Organism
smut  Streptococcus mutans GS-5 (serotype c)
SSDB
Motif
Pfam: Transgly_assoc DUF5862 Gly-zipper_Omp Rick_17kDa_Anti
Other DBs
NCBI-ProteinID: AFM81568
LinkDB
Position
complement(1112584..1112826)
AA seq 80 aa
MGLLWSLIVGALIGAIAGAITNRGKAMGCIANIFAGLVGSWAGQALFGSWGPSLAGMALL
PSILGAVIVVAVISFFFGEN
NT seq 243 nt   +upstreamnt  +downstreamnt
atgggattactttggtcactaatagtaggagcacttattggagcaattgcaggtgctatt
acgaatagaggaaaagcaatgggttgcattgctaatatttttgcaggattagtcggttct
tgggcaggtcaagctttgtttggcagttggggacctagtttagctggtatggctcttctt
ccgtctattctgggagcagtaattgtggtagctgttatttccttcttttttggtgaaaat
taa

DBGET integrated database retrieval system