Streptococcus mutans GS-5 (serotype c): SMUGS5_06910 Help Entry SMUGS5_06910      CDS       T02185                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism smut  Streptococcus mutans GS-5 (serotype c) Pathway smut00190   Oxidative phosphorylation smut01100   Metabolic pathways Module smut_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:smut00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     SMUGS5_06910  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:smut00194]     SMUGS5_06910 Photosynthesis proteins [BR:smut00194]  Photosystem and electron transport system   F-type ATPase [OT]    SMUGS5_06910 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  AFM81877 LinkDB All DBs Position complement(1461692..1461892) Genome browser AA seq 66 aa AA seqDB search MNLKILALGIAVLGVSLGEGILVANIAKSAARQPEMYGKLQTLMIMGVAFIEGTFFVLLA STFFVG NT seq 201 nt NT seq  +upstreamnt  +downstreamnt ttgaatttaaagattttagcacttgggattgctgttttaggcgttagccttggtgaagga attttagttgctaatattgcaaaatctgcagctcgtcagcctgaaatgtatggtaaatta caaacgctcatgattatgggtgttgcctttattgaaggtacctttttcgtgcttcttgct tcaacattctttgttggctga

DBGET integrated database retrieval system