KEGG   Serratia marcescens WW4: SMWW4_v1c10920
Entry
SMWW4_v1c10920    CDS       T02448                                 
Symbol
pigM
Name
(GenBank) prodigiosin biosynthesis protein PigM
  KO
K21785  4-hydroxy-2,2'-bipyrrole-5-methanol dehydrogenase
Organism
smw  Serratia marcescens WW4
Pathway
smw00333  Prodigiosin biosynthesis
smw01100  Metabolic pathways
smw01110  Biosynthesis of secondary metabolites
Module
smw_M00837  Prodigiosin biosynthesis, L-proline => prodigiosin
Brite
KEGG Orthology (KO) [BR:smw00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    SMWW4_v1c10920 (pigM)
SSDB
Motif
Pfam: Nitroreductase TM1586_NiRdase
Other DBs
NCBI-ProteinID: AGE16896
LinkDB
Position
complement(1212760..1213818)
AA seq 352 aa
MTQDLFAAALQQAVDIARQAPSSHNCQPWSLHYNAAARCGRLAIDRRRALQSLPSLEREM
LMSCGIFFEYLSALLNCAGSPLAWRWEHGPTHLLSFAPAAPAAPDRAAHHQLAQLIGERH
TARAAYQPTPINEAQRMQLQTLFDGTASSLSIAGDERARRRVAQLTARHAALDFSDRQAW
RETYQYIRFNERQPTDDGFHLHHLFGPVSPAFKRFFQVAFHPRLSRLATGLRLPAYMAQG
LAQRVAEGPQYLALCLNDESAEHLFATGMRLGRLWLTLQHWGWGLHPISVLVQHAEARRE
LAATLALSAPPVFFARFGHLQQWGSAAPRRSWQSILTAPPSGECAPPGNDFP
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgacccaagaccttttcgccgcggcgctgcaacaggccgtggacatcgcgcggcaggcg
ccctcttcacacaactgccaaccctggtctctccactataacgccgccgcccgatgtggc
cggttggctatcgaccgccgtcgcgccttgcagagcctgccttcgctggaacgcgagatg
ctgatgagctgcgggattttcttcgagtacctcagcgcgctgctcaactgtgcaggctcg
cctctcgcctggcgttgggagcatggccccacgcatttactgagctttgcccccgccgcg
cctgccgcgcccgatcgcgccgcccatcaccaattggcgcagctgatcggcgagcggcat
accgcacgagcggcctatcagcctacgccaatcaatgaagcgcagcggatgcagctgcag
accctgttcgacggaacggcgagttcgctcagtatcgcaggtgacgaacgcgctcgccgt
cgggtcgcgcagctcaccgctcgtcacgccgcgctcgatttctcggatcgccaagcctgg
cgcgaaacctatcaatacatccgcttcaacgaacggcagcctaccgacgacggttttcac
ctgcaccacctgtttggcccggtatccccagcattcaagcgcttcttccaagtggcgttt
catcctcgcttaagccggctggcgaccgggctgcgcttgccggcttatatggcgcaaggg
ctggcgcaacgcgtcgcggaaggcccgcaatacctggcgctgtgtctgaacgacgaaagt
gccgagcacctgttcgccaccggcatgcggcttggacgtctgtggctcacgctgcaacac
tggggttggggattgcatccgatcagcgttctggtgcaacacgccgaggcgcgtcgcgag
ctcgcagcaaccctggcgctcagcgctcccccggtgttttttgcccgcttcggccacctg
caacaatggggcagcgcagcacccagacgcagctggcaaagcattttgaccgcgccgcca
tccggcgaatgcgcgcccccggggaacgatttcccctaa

DBGET integrated database retrieval system