Serratia marcescens WW4: SMWW4_v1c10980 Help Entry SMWW4_v1c10980    CDS       T02448                                  Symbol pigG Name (GenBank) peptidyl carrier protein   KO K21781   peptidyl carrier protein Organism smw  Serratia marcescens WW4 Pathway smw00333   Prodigiosin biosynthesis smw01100   Metabolic pathways smw01110   Biosynthesis of secondary metabolites Module smw_M00837   Prodigiosin biosynthesis, L-proline => prodigiosin Brite KEGG Orthology (KO) [BR:smw00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00333 Prodigiosin biosynthesis     SMWW4_v1c10980 (pigG) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AGE16902 LinkDB All DBs Position complement(1220482..1220745) Genome browser AA seq 87 aa AA seqDB search MLESKLIQHIATQYLDGDHDGLNAQTPLFELNVVDSASIFDLVDFLRQESHVAIGMHEIH PANFASVQAMVALVQRLQAQVAAGGVA NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgttagaaagcaaattgatccagcatatcgccacccagtatctggatggcgatcacgac ggcctgaacgctcaaaccccgctgtttgaactgaacgtcgtcgattccgcctccattttc gatctggtggattttctgcgtcaggagtctcatgtcgccatcggcatgcatgagatccat ccggcgaatttcgcctcggtgcaggcgatggtcgcgctggtgcaacggttgcaagcgcaa gtcgccgcagggggtgtcgcatga

DBGET integrated database retrieval system