KEGG   Serratia marcescens WW4: SMWW4_v1c11000
Entry
SMWW4_v1c11000    CDS       T02448                                 
Symbol
pigE
Name
(GenBank) aminotransferase
  KO
K21778  3-acetyloctanal aminotransferase [EC:2.6.1.-]
Organism
smw  Serratia marcescens WW4
Pathway
smw00333  Prodigiosin biosynthesis
smw01100  Metabolic pathways
smw01110  Biosynthesis of secondary metabolites
Module
smw_M00837  Prodigiosin biosynthesis, L-proline => prodigiosin
Brite
KEGG Orthology (KO) [BR:smw00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    SMWW4_v1c11000 (pigE)
Enzymes [BR:smw01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-
     SMWW4_v1c11000 (pigE)
SSDB
Motif
Pfam: Aminotran_3 DUF5587
Other DBs
NCBI-ProteinID: AGE16904
LinkDB
Position
complement(1221796..1224357)
AA seq 853 aa
MKFGFIAHPTSLGLKRYVKMLDLLQRNSTEQHSGYTRELWERQNLVPFMNFARITSATGA
TCEGVIKYMPLVADEMLADARGIAARVVQGIEELAGDGAELVGLGGFTSIVGRRGEATAE
KSPVPVTSGNSLTTYAGYKALMQIQSWLEIRPEEEPVAIVGYPGSICLALSRLLLAHGFS
LHLLHRAGNHDRSELLSHLPEEYHSRVTLTSDPEDLYPRCKLFAAATSAGGVIDPARLQP
GSIFIDVALPRDIASETRPARDDILIIDGGCVTATDAVKLGGESLNVTIKQQLNGCMAET
IVLALENRRENFSLGRYLAPEKVLEIGEIAERHGFFAYPLASYGERIDRQSVTNLKRYYH
HDIYAGESADAALPASRLAFIDAVIAQTPAREDTLDRYHQYINPMMVDFLKLQRCDNVFR
SAAGTQLYDDAGEAFLDMVAGYGCLNLGHNPQPVVNALKNYLDAQGPNFIQYISIPEQTA
KLAEVLCRLAPGNMGRVFFSNSGTEAVEAAMKIAKASTGKPGIAYLRNSYHGKTLGALSI
TGRDKHRRYFTPLLDAMVEVPFGDLAALREALNREDVGALMIEPIQGEGGVHIPPAGYLQ
AVQQLCRETGVLLMVDEVQTGLGRTGKLFACEWDGIEPDVLMLSKSLSGGLIPIGATLCR
ADLWQKAYGTADRFLVHSSTYGGGNLASVVALSALREILAQDLVGHAERMGAYFKQALSE
IAARYPFVSEVRGRGLMLGIQFDQAFTGAVNASAREFATRLPGDWHTTWKFLPDPVQAHL
RAAMDRMEQALGEMFCMKFVTKLCQDHKILTFITANSSTVIRIQPPLIISKAEIDRFVGA
FATVCEELSTFLD
NT seq 2562 nt   +upstreamnt  +downstreamnt
atgaaattcggattcatcgctcatcccacctcgctggggttgaaacgttacgtcaaaatg
ctcgatctgctgcaacgcaactcgaccgagcagcacagcggctatacgcgtgaactgtgg
gaacgacaaaacctggttccctttatgaacttcgccaggatcacctcggcgaccggcgcc
acttgcgaaggggtgatcaaatacatgccgctggtggcggatgaaatgctggccgacgca
cgcggtatcgccgccagggtggtccaaggcatcgaagagctggccggcgatggcgccgaa
ctggtcggtctcggcggttttacctctatcgttgggcgacgcggcgaagccactgcggaa
aagtcgccggtgccggtcacctccggcaactcgctgaccacctacgccggctacaaggcc
ttgatgcagatccagtcctggctggaaatccgcccggaggaggaacccgtcgccatcgtc
ggctatccgggatcgatctgcctggcgctaagccgtctgctgctggcgcacggtttctct
ctccatttgctgcaccgcgccggcaaccatgatcgcagcgaactgctcagccatttgccc
gaggagtatcactcgcgcgtcaccctgaccagcgatcccgaagatctctacccgcgctgc
aaactgtttgccgccgcgacctccgccggcggcgtgatcgaccccgccagactgcaaccc
ggctcgatcttcatcgacgtggcgctgccgcgcgatatcgcttcggaaacgcgcccggcg
cgggatgacattctgatcatcgacggcggctgcgtcaccgccaccgatgcggtcaagttg
ggtggagaatcgctcaacgtcaccatcaagcaacaattgaacggctgcatggcggaaacc
attgtgctggcgctggaaaaccggcgggaaaacttttcgctgggccgctatctggcgccg
gaaaaagtgctggagatcggtgaaatcgccgagcgccacgggttcttcgcctatccgctg
gcctcgtacggcgagcgcatcgatcggcagagcgtgaccaatctcaagcgctactaccac
catgacatctatgccggggaatcggctgatgcggcgttgcccgcatcgcgcctggcgttt
atcgacgcggtcatcgcccaaacgccggccagggaagacaccctcgaccgctatcatcaa
tacatcaaccccatgatggtggacttcctcaagttgcagcgctgcgacaacgttttccgc
agcgccgccggcacccagttgtatgacgatgcgggcgaggctttcctggacatggtggcg
ggctacgggtgcctaaacctgggccacaacccgcagccagtggtcaacgcgctgaaaaac
tacctcgacgctcaaggccccaacttcattcaatacatttccattcccgaacagaccgcc
aagctggccgaagtgctctgtcgtctggcgccgggcaacatgggccgggtgttcttcagc
aactccggcaccgaagccgtcgaggccgcgatgaagatcgccaaggcctcgacgggcaag
ccgggcatcgcctatctgcgcaacagttaccacggtaaaacgctgggcgcgttgtccatc
accggacgagacaaacaccgccgctatttcacaccgctgctggacgcgatggtggaagtg
ccgttcggcgatctcgccgcgctgcgggaagcgctgaaccgtgaagacgtcggcgcgctg
atgatcgaaccgatccagggcgaaggcggcgtgcatatcccgcccgccggttacctgcag
gcggtgcagcagctctgccgcgagaccggcgtgctgctgatggtggacgaagtgcaaacc
gggcttgggcgcaccggcaaacttttcgcctgcgaatgggacggtatcgagccggacgtg
ctgatgctgtcgaaatccctgtccggcggcctgatccccatcggcgccacgctgtgccga
gccgatctttggcaaaaagcctatggcacggcggatcgcttcctggtgcacagctccacc
tacggcggcggcaacctcgcctcggtcgtcgccctcagcgcgctgcgcgagatcctggcg
caggatttggtcggccatgccgaacggatgggcgcctactttaagcaggcactgagtgag
atcgccgcccgctatccgttcgtcagcgaggtgcgcggccgcggcctgatgctggggatc
cagttcgaccaggcgttcaccggcgcggtcaacgcctccgcccgcgaattcgccacccgg
ctgccgggcgattggcacaccacctggaaattcttgcccgatccggtgcaagcccatctg
cgggcggcgatggatcgcatggaacaggcgctcggcgaaatgttctgcatgaaattcgtc
accaagctgtgccaggaccacaagatcctgaccttcattaccgccaacagctcgacggtg
atccgtattcaacccccgctcatcatcagcaaagccgagatcgaccgtttcgtcggcgcc
tttgccacggtgtgcgaggaactctccacctttttagactag

DBGET integrated database retrieval system