Serratia marcescens WW4: SMWW4_v1c12380 Help Entry SMWW4_v1c12380    CDS       T02448                                  Name (GenBank) hypothetical protein   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism smw  Serratia marcescens WW4 Pathway smw00190   Oxidative phosphorylation smw01100   Metabolic pathways smw02020   Two-component system Module smw_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:smw00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     SMWW4_v1c12380  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     SMWW4_v1c12380 Enzymes [BR:smw01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      SMWW4_v1c12380 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  AGE17042 LinkDB All DBs Position 1376463..1376576 Genome browser AA seq 37 aa AA seqDB search MWYFAWILGTLLACAFGIITALALEQSEATKAQQDGK NT seq 114 nt NT seq  +upstreamnt  +downstreamnt atgtggtattttgcctggattctcggaacgcttcttgcctgcgccttcggcatcatcacg gcgctggcgcttgagcagagcgaagcgaccaaagctcagcaagacggtaagtaa

DBGET integrated database retrieval system