Serratia marcescens WW4: SMWW4_v1c18540 Help Entry SMWW4_v1c18540    CDS       T02448                                  Symbol dinI Name (GenBank) DNA damage-inducible protein I   KO K12149   DNA-damage-inducible protein I Organism smw  Serratia marcescens WW4 Brite KEGG Orthology (KO) [BR:smw00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:smw03400]     SMWW4_v1c18540 (dinI) DNA repair and recombination proteins [BR:smw03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     SMWW4_v1c18540 (dinI) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI DUF5388 Motif Other DBs NCBI-ProteinID:  AGE17655 LinkDB All DBs Position complement(2040334..2040573) Genome browser AA seq 79 aa AA seqDB search MRVEVTIDKTRPLPAGAIEALTGELGKRVNRQFPDAVVHVRYAGANGLSVLGGAKTDRDL IEEILQETWESADEWFSAE NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgcgtgttgaagtcactatagataaaacccggccgctgccggcgggcgccattgaggcg ctgaccggtgaactgggcaagcgggtcaaccgccagtttccagacgccgtcgtgcacgta cgttatgccggcgccaacgggctctccgtgctggggggcgccaaaaccgaccgggatctg atcgaggaaatccttcaggaaacctgggaaagcgcagacgaatggtttagcgcagaataa

DBGET integrated database retrieval system