Serratia marcescens WW4: SMWW4_v1c18660 Help Entry SMWW4_v1c18660    CDS       T02448                                  Symbol acpP Name (GenBank) acyl carrier protein (ACP)   KO K02078   acyl carrier protein Organism smw  Serratia marcescens WW4 Pathway smw01100   Metabolic pathways smw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:smw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SMWW4_v1c18660 (acpP)    00074 Mycolic acid biosynthesis     SMWW4_v1c18660 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SMWW4_v1c18660 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Motif Other DBs NCBI-ProteinID:  AGE17667 LinkDB All DBs Position 2052391..2052627 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIVEQLGVKQEEVLNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDFINASQQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaatcattgttgagcaactgggtgttaaacag gaagaagttttgaacaacgcttctttcgttgaagatctgggcgctgattctcttgacacc gttgagctggtaatggcactggaagaagaattcgacaccgagattccagacgaagaagct gagaagatcactactgttcaggcagctattgatttcatcaacgctagccagcagtaa

DBGET integrated database retrieval system