Serratia marcescens WW4: SMWW4_v1c32750 Help Entry SMWW4_v1c32750    CDS       T02448                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism smw  Serratia marcescens WW4 Pathway smw01100   Metabolic pathways smw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:smw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SMWW4_v1c32750    00074 Mycolic acid biosynthesis     SMWW4_v1c32750   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SMWW4_v1c32750 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AGE19069 LinkDB All DBs Position 3533028..3533288 Genome browser AA seq 86 aa AA seqDB search MLNRDAVMDYILTCLQGIVEGGVEIKPDSDLVNDLGLESIRVLDLLMMLEDELDISIPIN ILLDVRTPEQLLDALRPYLEKNHGTV NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgctaaatcgcgatgctgtaatggattatatcctgacgtgtttgcaaggtatcgtcgaa ggcggagtggaaataaaacctgatagcgatctcgtcaatgatcttggcctggaatccatc agagtcttggatctgctgatgatgctggaagatgaattagatatctccattcctatcaat atattgcttgatgtcagaacgcctgagcaactgcttgacgcgctgcgcccttatctggag aaaaaccatgggactgtatga

DBGET integrated database retrieval system