Sinorhizobium meliloti SM11: SM11_chr0950 Help Entry SM11_chr0950      CDS       T01885                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism smx  Sinorhizobium meliloti SM11 Pathway smx01100   Metabolic pathways smx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:smx00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SM11_chr0950    00074 Mycolic acid biosynthesis     SM11_chr0950   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SM11_chr0950 SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  AEH78227 UniProt:  F7X2L5 LinkDB All DBs Position complement(972548..972796) Genome browser AA seq 82 aa AA seqDB search MSDHQLYLSQVADVIRELFDEYDGPITLETTARDVPQWDSLSNVRLMVLIEQELAVRFST AEVQGFKNLGSLIDAVVKRKQN NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgtctgaccatcaactttatctatctcaagtcgcagacgtgatccgtgagctgttcgat gaatacgacggcccgattacgctggagacgacggcccgcgacgttccgcaatgggacagc ctgtccaatgtcagactgatggttctgatcgagcaggagctcgcagtccgcttcagcacg gctgaggtgcaaggtttcaagaacctcggcagccttatcgatgccgtggtcaagcgcaag cagaactga

DBGET integrated database retrieval system