KEGG   Sinorhizobium meliloti SM11: SM11_chr1403
Entry
SM11_chr1403      CDS       T01885                                 

Name
(GenBank) putative gentiobiose, salicin and cellobiose ABC transporter, permease component
  KO
K17316  glucose/mannose transport system permease protein
Organism
smx  Sinorhizobium meliloti SM11
Pathway
smx02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:smx00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SM11_chr1403
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:smx02000]
    SM11_chr1403
Transporters [BR:smx02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Glucose/mannose transporter
    SM11_chr1403
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-ProteinID: AEH78679
UniProt: F7X627
LinkDB
Position
1428508..1429416
AA seq 302 aa
MTGLTRGSARPNQWLRNLNAKIASIPMILTAMVIFVGGTAWTVVYSFTNSKLLPRLAFVG
FDQYERLWAAPRWLVSIQNLAVFGCLSLVFSLVIGFVLAALMDQKIRFENTFRTIMLYPF
ALSFIVTGLVWQWLLNPQYGIQSIVRSLGWTSFSFDPLYNSNIVIYGILIAALWQGTGLV
MCLMLAGLRGIDEDIWKAARVDGIPMWKTYVLIIIPMMRGVFITTLVIIASGIVKVYDLV
VAQTSGGPGIASEVPAKYVYDYMFQAQNLGQGFAASTMMLVTVAIIIVPWAYLEFGGGRK
RG
NT seq 909 nt   +upstreamnt  +downstreamnt
atgacaggtctaacacgtggctcggcgcggccgaaccagtggctgcgaaacctgaatgcg
aagatcgcctctatcccgatgatactcacggccatggtcatcttcgtgggcggcacggcc
tggacggtcgtctactcctttaccaattccaagctcctgccgcggctcgccttcgtcggc
ttcgaccagtatgagcggctgtgggccgcgcctcgctggctggtctcgatccagaatctg
gcggtcttcggttgcctctcgctggttttcagcctggtgatcggcttcgtcctggccgcc
ctgatggatcagaagatccgtttcgagaacacgttccggacgatcatgctctatccgttc
gccctgtcgttcatcgtcaccggtctcgtctggcaatggctgctcaatccgcaatacgga
atccagtcgatcgtcaggtctcttggatggacgagcttctccttcgacccgctctacaat
tcgaacatcgtcatttacggcattctcatcgccgcgctgtggcagggaacgggcctcgtc
atgtgcctgatgctggccgggttgcgagggatcgacgaggacatctggaaagcggcccgg
gtcgacggcatcccgatgtggaagacctatgtgctgatcataatcccgatgatgcgcggc
gtcttcatcaccactctggtgatcatcgcgagcggcatcgtcaaggtctacgacctcgtc
gtggcgcagacgagcggcggcccgggcatcgcctccgaagtgcccgccaaatacgtctac
gactacatgttccaggcccagaacctgggccagggctttgccgcctccaccatgatgctc
gtgaccgtcgcgatcatcatcgtgccgtgggcatatctggagttcggaggagggcgcaag
cgtggataa

DBGET integrated database retrieval system