Sinorhizobium meliloti SM11: SM11_chr2410 Help Entry SM11_chr2410      CDS       T01885                                  Symbol acpP2 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism smx  Sinorhizobium meliloti SM11 Pathway smx01100   Metabolic pathways smx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:smx00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SM11_chr2410 (acpP2)    00074 Mycolic acid biosynthesis     SM11_chr2410 (acpP2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SM11_chr2410 (acpP2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  AEH79664 UniProt:  F7X478 LinkDB All DBs Position 2385257..2385508 Genome browser AA seq 83 aa AA seqDB search MENSSADAASRVRAIIIEQLGIDPARAVDEASIVDDLGADYLEVAQIVMMIEDEFNIEIS DDVAEAVITVGDVIYVVMSKTES NT seq 252 nt NT seq  +upstreamnt  +downstreamnt gtggaaaactccagcgcggacgccgctagccgtgtaagagcaataatcatcgagcagttg ggcatcgaccctgcccgggctgtggacgaagcgtccattgtagatgacctcggcgccgac tatctcgaagtcgctcaaatcgtcatgatgattgaggacgagttcaacatcgaaatttca gatgacgtggccgaagccgttatcacggtcggagatgtaatttacgtggtgatgtcgaaa accgagagctag

DBGET integrated database retrieval system