Sinorhizobium meliloti SM11: SM11_chr2521 Help Entry SM11_chr2521      CDS       T01885                                  Symbol acpP3 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism smx  Sinorhizobium meliloti SM11 Pathway smx01100   Metabolic pathways smx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:smx00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SM11_chr2521 (acpP3)    00074 Mycolic acid biosynthesis     SM11_chr2521 (acpP3)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SM11_chr2521 (acpP3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Delta_lysin Motif Other DBs NCBI-ProteinID:  AEH79774 UniProt:  F7X4Z8 LinkDB All DBs Position complement(2492636..2492872) Genome browser AA seq 78 aa AA seqDB search MSDIAERVKKIVIDHLGVDAEKVSEGASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA DSILTVGDAVKFIEKAQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgcagaacgcgtgaagaaaattgttattgatcatcttggcgtcgacgcc gaaaaggtcagcgaaggcgcaagcttcatcgatgacctcggcgcggactcgctcgacacc gtcgaactggtcatggcattcgaagaggaattcggtgtcgaaatcccggacgacgcagca gattcgatcctcaccgttggcgacgccgtcaagttcatcgagaaagcccaggcctga

DBGET integrated database retrieval system